Home / NPY Receptor Agonists / Peptide YY (3-36)

Peptide YY (3-36)

Catalog #: 1618
1 Citation Datasheet
Catalog # Availability Size / Price Qty
1618/500U
Peptide YY (3-36)
1 Image
Description: Selective NPY Y2 receptor agonist
Alternative Names: PYY 3-36

Purity: ≥95%

Product Details
Citations (1)
Supplemental Products
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Peptide YY (3-36) is a Y2 selective agonist. IC50 values are 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Inhibits food intake and reduces weight gain in vivo. Brain penetrant.

Technical Data

M.Wt:
3980.4
Formula:
C176H272N52O54
Sequence:
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY

(Modifications: Tyr-34 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
126339-09-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Gut hormone PYY3-36 physiologically inhibits food intake.
    Batterham et al.
    Nature, 2002;418:650
  2. Primary structures of PYY, [Pro34]PYY and PYY-(3-36) confer different conformations and receptor selectivity.
    Keire et al.
    Am.J.Physiol.Gastrointest.Liver Physiol., 2000;279:G126
  3. Characterization of blood-brain barrier permeability to PYY3-36 in the mouse.
    Nonaka et al.
    J.Pharmacol.Exp.Ther., 2003;306:948
  4. High-fat food biases hypothalamic and mesolimbic expression of consummatory drives
    CM Mazzone, J Liang-Gual, C Li, NS Wolcott, MH Boone, M Southern, NP Kobzar, IA Salgado, DM Reddy, F Sun, Y Zhang, Y Li, G Cui, MJ Krashes
    Nat. Neurosci., 2020;0(0):.
  5. High-fat food biases hypothalamic and mesolimbic expression of consummatory drives
    CM Mazzone, J Liang-Gual, C Li, NS Wolcott, MH Boone, M Southern, NP Kobzar, IA Salgado, DM Reddy, F Sun, Y Zhang, Y Li, G Cui, MJ Krashes
    Nat. Neurosci., 2020;0(0):.

Product Datasheets

COA view current batch
Or select another batch:
View Batch
SDS

Citation for Peptide YY (3-36)

The citations listed below are publications that use Tocris products. Selected citations for Peptide YY (3-36) include:

1 Citation: Showing 1 - 1

  1. Peptide YY3-36 and 5-hydroxytryptamine mediate emesis induction by trichothecene deoxynivalenol (vomitoxin).
    Authors: Wu Et al.
    Toxicol Sci  2013;133:186

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Peptide YY (3-36)

There are currently no reviews for this product. Be the first to review Peptide YY (3-36) and earn rewards!

Have you used Peptide YY (3-36)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.