LL 37

Catalog # Availability Size / Price Qty
5213/1
LL 37
1 Image
Description: Antimicrobial peptide derivative of human cathelicidin

Purity: ≥95%

Product Details
Citations (3)
Reviews

Biological Activity

LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (Kd = 11.2 nM) and by binding to ACE2 (Kd = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.

Technical Data

M.Wt:
4493.32
Formula:
C205H340N60O53
Sequence:
[LL-37, 37 aa]
Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
154947-66-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Or select another batch:
View Batch

Citations for LL 37

The citations listed below are publications that use Tocris products. Selected citations for LL 37 include:

3 Citations: Showing 1 - 3

  1. ApoM binds endotoxin contributing to neutralization and clearance by High Density Lipoprotein.
    Authors: Susu M Et al.
    Biochem Biophys Rep  2023;34:101445
  2. HBD-2 binds SARS-CoV-2 RBD and blocks viral entry: Strategy to combat COVID-19.
    Authors: Liqun Et al.
    iScience  2022;25:103856
  3. IL-37 Expression Is Downregulated in Lesional Psoriasis Skin.
    Authors: Christian Et al.
    Immunohorizons  2020;4:754-761

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for LL 37

There are currently no reviews for this product. Be the first to review LL 37 and earn rewards!

Have you used LL 37?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.