Klotho-derived peptide 1
1 Image
Description: TGF-β receptor 2 (TβR2) binding peptide; disrupts the TGF-β/TβR2 interaction
Purity: ≥95%
Biological Activity
Klotho-derived peptide 1 (KP1) is a peptide that binds to TGF-β receptor 2 (TβR2) (Kd = 1.4 μM). It inhibits TGF-β signaling by blocking TGF-β/TβR2 interaction. In mouse models of renal fibrosis, intravenous injection of KP1 results in its specific accumulation in the injured kidneys. It suppresses TGF-β signaling, repressing fibroblast activation and ameliorates kidney fibrosis in vivo.Technical Data
M.Wt:
3228.48
Formula:
C149H203N39O43
Sequence:
FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG
Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets
Or select another batch:
View Batch
FAQs
No product specific FAQs exist for this product, however you may
View all Peptide FAQsReviews for Klotho-derived peptide 1
There are currently no reviews for this product. Be the first to review Klotho-derived peptide 1 and earn rewards!
Have you used Klotho-derived peptide 1?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris Bioscience is the leading supplier of novel and exclusive
tools for
life science research with over 30 years' experience in the
industry.
Tocris is a Bio-Techne brand.
