Echistatin, α1 isoform

Catalog #: 3202
2 Citations Datasheet

Catalog #	Availability	Size / Price	Qty
3202/100U

1 Image

Description: αVβ3 and glycoprotein IIb/IIIa (integrin αIIbβ3) inhibitor

Purity: ≥95%

View All Products for Integrin Receptor Inhibitors

Product Details

Citations (2)

Supplemental Products

Reviews

Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Echistatin, α1 isoform is a potent irreversible α_Vβ₃ integrin antagonist (K_i = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC₅₀ = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, α_IIbβ₃) receptors (IC₅₀ = 30 nM) in vitro.

Technical Data

M.Wt:

5417.1

Formula:

C₂₁₇H₃₄₁N₇₁O₇₄S₉

Sequence:

ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

(Modifications: Disulfide bridges: 2-11, 7-32, 8-37, 20-39)

Solubility:

Soluble to 1 mg/ml in water

Purity:

≥95%

Storage:

Store at -20°C

CAS No:

154303-05-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms.
Musial et al.
Circulation, 1990;82:261
Echistatin is a potent inhibitor of bone resorption in culture.
Sato et al.
J.Cell.Biol., 1990;111:1713
Biochemical characteriation of the binding of echistatin to integrin α_Vβ₃ receptor.
Kumar et al.
J.Pharmacol.Exp.Ther., 1997;283:843

Product Datasheets

COA view current batch

Or select another batch:

View Batch

SDS

Citations for Echistatin, α1 isoform

The citations listed below are publications that use Tocris products. Selected citations for Echistatin, α1 isoform include:

2 Citations: Showing 1 - 2

Angiopoietin-like 3 induces podocyte F-actin rearrangement through integrin α(V)β3/FAK/PI3K pathway-mediated Rac1 activation.
Authors: Lin Et al.
PLoS One 2013;2013:135608
Matrix stiffness modulates proliferation, chemotherapeutic response, and dormancy in hepatocellular carcinoma cells.
Authors: Schrader Et al.
Biomed Res Int 2011;53:1192

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Echistatin, α1 isoform

There are currently no reviews for this product. Be the first to review Echistatin, α1 isoform and earn rewards!

Have you used Echistatin, α1 isoform?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.